Special characters and symbols- Page 63

Brother MFC-4420C User's Guide

User's Guide

Quick Setup Guide

2014 Dodge Charger SRT Owner Manual

USER'S GUIDE

Brother numbers

Frequently Asked Questions (FAQs)

For Customer Service

Brother fax back system (USA only)

Ordering accessories and supplies

Notice - Disclaimer of Warranties (USA and Canada)

Compilation and Publication Notice

Brother® One Year Limited Warranty and Replacement Service (USA only)

BROTHER MULTIFUNCTION CENTER/FACSIMILE MACHINE LIMITED WARRANTY (Canada only)

Safety Precautions

To Use the MFC Safely

Choosing a Location

Quick Reference Guide

Sending Black & White Faxes

Symbols used in this Guide

Fax Test Sheet and Product Registration (USA only)

On-Line Registration (USA and Canada)

MFC Part Names and Functions

MFC-4420C control panel overview

Turning the MFC on and off

Do you have Voice Mail on the phone line?

Why should there be problems?

How can you avoid possible problems?

Fax tones and handshake

ECM (Error Correction Mode)

Connecting the MFC

Connecting an External Telephone

Connecting an External Telephone Answering Device (TAD)

Sequence

Connections

Recording Outgoing Message (OGM) on an External TAD

Special Line Considerations

Roll Over Phone Lines

Two-Line Phone System

Converting Telephone Wall Outlets

Installing MFC, External Two-Line TAD and Two-Line Telephone

Multi-Line Connections (PBX)

If you are Installing the MFC to Work with a PBX

Custom Features on Your Phone Line

2 Paper

About paper

Handling and using special paper

Recommended paper

Paper capacity of the Paper Tray

Paper specifications for the Paper Tray

Paper capacity of the Output Paper Support

Printable area

How to load paper and envelopes

To load paper or other media

To load glossy paper

To load envelopes

3 On-Screen Programming

User-friendly programming

Setting the Paper Type

Setting the Paper Size

Setting the Date and Time

Setting the Station ID

Special characters and symbols

Setting the Ring Volume

Setting the Beeper Volume

Setting the Speaker Volume

Turning on Automatic Daylight Savings Time

Setting the LCD Contrast

˘˘˘Setting Tone and Pulse dialing mode

5 Setup Receive

Basic receiving operations

Choosing the Receive Mode

To select or change your Receive Mode

Setting the Ring Delay

Setting the F/T Ring Time (FAX/TEL mode only)

Easy Receive

Printing a reduced incoming fax (Auto Reduction)

Receiving a fax at the end of a conversation

Advanced receiving operations

Operation from extension telephones

For FAX/TEL mode only

Using a cordless external handset

Changing the remote codes

Printing a fax from the memory

Polling

Setting up Polling Receive

Setting up Sequential Polling Receive

˘˘Telephone services

Distinctive Ring

What does your telephone company’s ‘Distinctive Ring’ do?

What does Brother’s ‘Distinctive Ring’ do?

Do you have Voice Mail?

Before you choose the ring pattern to register

Registering the Distinctive Ring pattern

Very important

Turning off the Distinctive Ring

Caller ID

Viewing Caller ID List

Printing Caller ID List

Automatic Transmission

Faxing A4 size originals from the scanner glass

Out of memory message

Manual Transmission

Sending a fax at the end of a conversation

Basic sending operations

Sending faxes using multiple settings

Contrast

Fax resolution

Color fax transmission

Manual and automatic fax redial

Dual Access (Not available for color faxes)

Real Time Transmission

Checking job status

Canceling a job while scanning, dialing and sending the original

Canceling a scheduled job

Advanced sending operations

Broadcasting (Not available for color faxes)

Overseas Mode

˘Delayed Fax (Not available for color faxes)

Delayed Batch Transmission (Not available for color faxes)

Setting up Polled Transmission (Not available for color faxes)

7 Auto Dial numbers and Dialing options

Storing numbers for easy dialing

Storing Speed Dial numbers

Changing Speed Dial numbers

Setting up Groups for Broadcasting

Dialing options

Access codes and credit card numbers

Fax Forwarding/Paging

Programming a Fax Forwarding number

˘Programming your pager number

Setting your remote access code

Remote retrieval

Using your remote access code

Remote commands

Retrieving fax messages

Changing your Fax Forwarding number

9 Printing reports

MFC settings and activity

Customizing the Transmission Verification Report

Setting the Fax Activity Report Interval

Printing reports

To print a report

10 Making copies

Using the MFC as a copier

Single or multiple copies

Out of memory message

Using Copy Options key (Temporary Settings)

Changing the default copy settings

11 Walk-Up PhotoCapture Center™

Introduction

PhotoCapture Center™ requirements

Basic flow

Getting started

Printing the Index (Thumbnails)

Printing images

Changing the settings for printing images

Color enhancement (True2Life®)

DPOF printing

Changing the default settings

Color enhancement (True2Life®)

Understanding the Error Messages

˘Using PhotoCapture Center™ from your PC

Using PhotoCapture Center™ for scanning originals

12 Using the MFC as a printer

Using the Brother MFC-4420C printer driver

Features

Choosing the right type of paper

How to print your document

˘Simultaneous printing and faxing

Clearing data from the memory

Checking the Print Quality

13 Printer driver settings

Printer driver settings

How to access the printer driver settings

Basic tab

Media Type

Quality

Bi-Directional Printing

14 How to scan using Windows®

Scanning a document (For Windows® 98/98SE/Me and 2000 Professional)

TWAIN compliant

How to access the Scanner

Scanning a document into the PC

Scanning a whole page

PreScanning to crop a portion you want to scan

Settings in the Scanner window

Scanning a document (For Windows® XP only)

WIA compliant

How to access the scanner

Scanning a document

PreScanning to crop a portion you want to scan

Brother Scanner Utility

Changing the default color file format

Using ScanSoft® PaperPort® and TextBridge® OCR

Viewing items

Organizing your items in folders

Quick links to other applications

ScanSoft® TextBridge® OCR lets you convert image text in to text you can edit

You can Import items from other applications

You can Export items in other formats

Exporting an image file

15 Using the Brother Control Center for Windows® 98/ 98SE/Me/2000 Professional

Brother MFL-Pro Control Center

AutoLoad the Brother Control Center

How to turn off AutoLoad

Brother Control Center features

Auto Configuration

Scan to key operations

Scan to File

To access Scan to File Configuration screen

Scanner Settings

Destination folder

Scan to E-mail

To access Scan to E-mail Configuration screen

Scanner Settings

E-mail application

Send to Options

Scan to OCR (Word Processor)

To access Scan to OCR Configuration screen

Scanner Settings

Word Processor

Scan Image

To access Scan to Image Configuration screen

Scanner Settings

Target Application

16 Using the Windows®-Based Brother SmartUI Control Center

Brother SmartUI Control Center

AutoLoad the Brother Control Center

How to turn off Auto Load

Brother Control Center features

Auto Configuration

Hardware Section: Changing the Scan to Button Configuration

Fax

Scan to OCR (Word Processing program)

Scan to Graphics application (example: Microsoft Paint)

Copy

Fax setting (PC-Fax using the Brother Fax Driver)

FAX settings

Custom: User-defined buttons

Customizing a user-defined button

1. Select the Scan Action

2. Select Configuration for the Scan Type.

3. Select Scan Settings.

17 Using MFC Remote Setup

MFC Remote Setup

18 Using PC-FAX

PC-FAX sending

Setting up user information

Setting up a Member in the Address Book

Setting up a Group for Broadcasting

Editing Member information

Deleting a Member or Group

Exporting the Address Book

Importing to the Address Book

Setting up a Cover Page

You can enter information in each field

Sending a file as a PC-FAX using the Facsimile style

Redial

Sending a file as a PC-FAX using the Simple style

19 Using the PhotoCapture Center™ from your PC

Introduction

Using ArcSoft® PhotoPrinter® 4

Overview of basic steps

20 Using your MFC with a Macintosh®

Setting up your USB-equipped Apple® Macintosh® G3, G4 or iMac™ or iBook™ with Mac OS 8.6-9.2 or M...

Using the Brother printer driver with your Apple® Macintosh® (OS 8.6-9.2)

Using the Brother Printer Driver with Your Apple® Macintosh® (OS X 10.1/10.2.1 or greater)

Choosing page setup options

Printing a document

Choosing printing options

Sending a fax from your Macintosh® application

Setting up your Address Book

Adding a new Member

Adding a new Group

Using the Brother TWAIN scanner driver with your Macintosh® (For Mac OS 8.6-9.2 and OS X 10.2.1 o...

Accessing the scanner

Scanning an image into your Macintosh®

Scanning a whole page

PreScanning an image

Settings in the Scanner window

MFC Remote Setup (Mac OS 10.1/10.2.1 or greater)

Using the PhotoCapture Center™ from a Macintosh®

Using ArcSoft® PhotoPrinter® 4

Overview of basic steps

21 Important information

Standard telephone and FCC Notices

These notices are in effect on models sold and used in the United States only.

Federal Communications Commission (FCC) Declaration of Conformity (USA only)

Important

Industry Canada Compliance Statement (Canada only)

Important safety instructions

Trademarks

22 Troubleshooting and routine maintenance

Troubleshooting

Error Messages

Printer Jam or Paper Jam

If you are having difficulty with your MFC

How to improve print quality

Cleaning the print head

Print Quality Check

Checking the ink volume

Packing and shipping the MFC

Routine maintenance

Cleaning the scanner

Replacing the ink cartridges

Fax

Computer Requirements

Consumable Items

Index

Remote Retrieval Access Card

brother

,1,7,$/6(783

6SHFLDOFKDUDFWHUVDQGV\PEROV

3UHVV

DQGWKHQSUHVV

WRPRYHWKHFXUVRUXQGHUWKH

VSHFLDOFKDUDFWHURUV\PERO\RXZDQW7KHQSUHVV

0HQX6HW

VHOHFWLW

3UHVV

IRU

VSDFH ¶

3UHVV

IRU

!"#>@AB

3UHVV

IRU

e¬ÊÇÌdÉg

127,&(

7KH7HOHSKRQH&RQVXPHU3URWHFWLRQ$FWRIPDNHVLWXQODZIXO

IRUDQ\SHUVRQWRXVHDFRPSXWHURUHOHFWURQLFGHYLFHWRVHQGDQ\

PHVVDJHYLDDWHOHSKRQHID[PDFKLQHXQOHVVVXFKPHVVDJHV

FOHDUO\FRQWDLQLQDPDUJLQDWWKHWRSRUERWWRPRIHDFKWUDQVPLWWHG

SDJHRURQWKHILUVWSDJHRIWKHWUDQVPLVVLRQWKHGDWHDQGWLPHLW

LVVHQWDQGDQLGHQWLILFDWLRQRIWKHEXVLQHVVRURWKHUHQWLW\RURWKHU

LQGLYLGXDOVHQGLQJWKHPHVVDJHDQGWKHWHOHSKRQHQXPEHURIWKH

VHQGLQJPDFKLQHVRUVXFKEXVLQHVVRWKHUHQWLW\RULQGLYLGXDO
,QRUGHUWRSURJUDPWKLVLQIRUPDWLRQLQWR\RXUID[PDFKLQH

FRPSOHWHWKHVWHSVGHVFULEHGRQSDJH

1 ... 596061626364656667

Detailed Information for Brother MFC-4420C User's Guide

Related Documents for Brother MFC-4420C User's Guide

Brother 775 User Manual

Brother PT-1700 User Manual

Brother PT-110 User Manual

Brother QL-570VM User's Guide

Brother HL-1870N User's Guide

Brother MFC J625DW Open Source Licensing Remarks

Brother 882-U70 User Manual

Brother 7550MC User Manual

Brother 1830 User Manual

Brother HL-5240 User's Guide

Brother BM-3600 Quick Start Guide

Brother 885-S61 User Manual

Brother PT 2300 User's Guide

Brother HL-3450CN Quick Setup Guide/ Network Setup Guide

Brother PT-1960 User's Guide

Brother DCP-8020 Quick Setup Guide

Brother DCP-8025D Network User's Guide

Brother DCP7020 User Manual

Brother MFC-3320CN User's Guide

Brother LN9953001 User Manual

Brother CP60X Warranty

Brother PT-1200 User Manual

Brother BE-1201 User Manual

Brother FAX-2920 Quick Setup Guide

Brother HL 2040 User's Guide

Brother PT-2610 User's Guide

Brother LB5000S Warranty

Brother PT-9700PC User's Guide

Brother DK1240 User Manual

Brother DCP-8045D User's Guide

Brother HL-5040 Quick Setup Guide

Brother NX-200 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother CS-8150 User's Guide

Brother HL-5150D Quick Setup Guide

Brother HL-5170DN Command Reference Guide for Software Developers

Brother PT-1600 User's Guide

Brother 885-U02 User Manual

Brother PT-1200 User Manual

Brother BAS-761 User Manual

Brother HL-6180DW Open Source Licensing Remarks

Brother HL-5280DW Command Reference Guide for Software Developers

Brother MFC-J875DW Open Source Licensing Remarks

Brother FAX-1860C Quick Setup Guide

Brother MFC-8460N Network User's Guide

Brother HL-5140 User Manual

Brother Fax User Manual

Brother LX-570 User Manual

Brother MFC-210C Quick Setup Guide

Brother HE 120 User's Guide

Brother HL-6050D User's Guide

Brother XL-3750 User's Guide

Brother MFC-5890CN Quick Setup Guide

Brother ADS2000 User Manual

Brother LB-6800 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother 5490CN User Manual

Brother HL-6050D Command Reference Guide for Software Developers

Brother XS3109 Notification about included accessories

Brother MFC-240C Quick Setup Guide

Brother 5440CN User Manual

Brother Personal Embroidery Design Software System User Manual

Brother MFC-5860CN Quick Setup Guide

Brother PT-2430PC User Manual

Brother HL-2460 User's Guide

Brother SB7500 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother 1034D Warranty

Brother BCL-D20 User Manual

Brother DCP-9040CN Quick Setup Guide

Brother 210C User Manual

Brother PT-9800PCN User's Guide

Brother FAX 1920CN User's Guide

Brother MFC J435W Open Source Licensing Remarks

Brother BES-1216 User Manual

Brother MFC-3340CN User's Guide

Brother PT-55 User Manual

Brother MFC-J4620DW Open Source Licensing Remarks

Brother DCP-135C User Manual

Brother PT-1400 User's Guide

Brother a User Manual

Brother MFC-9420CN Quick Setup Guide

Brother HL-4040CN Network User's Guide

Brother 1670N User Manual

Brother DCP-J152W Open Source Licensing Remarks

Brother DCP-120C User's Guide

Brother MFC-9420CN User's Guide

Brother FAX-1940CN Network User's Guide

Brother MFC J835DW Open Source Licensing Remarks

Brother TD-4000 User's Guide

Brother QL-550 Quick Start Guide

Brother Fax 1360 User's Guide

Brother MFC-7440N User's Guide

Brother MFC-620CN Network User's Guide

2020 Brother LS-2020 User's Guide

Brother FAX-2940 Open Source Licensing Remarks

Brother DCP-L2540DW Open Source Licensing Remarks

Brother PT-2310 User's Guide

Brother FAX-2910 Quick Setup Guide

Brother MFC-J4710DW Open Source Licensing Remarks

Brother MFC-8840D User's Guide

Brother MFC-5840CN Network User's Guide

Brother HL-5240 Command Reference Guide for Software Developers

Brother DCP-8040 Network User's Guide

Brother MFC-J4610DW Open Source Licensing Remarks

Brother MFC-J4510DW Open Source Licensing Remarks

Brother MFC-5490CN Quick Setup Guide

Brother PT-2410 User's Guide

Brother ST150HDH Warranty

Brother 885-U01 User Manual

Brother MFC J5910DW Open Source Licensing Remarks

Brother 882-U10 User Manual

Brother XF0606-001 User Manual

Brother FAX-2480C Quick Setup Guide

Brother 885-U11 User Manual

Brother P-touch 550 User Manual

Brother MFC-845CW Quick Setup Guide

Brother 1300 User Manual

Brother FAX-2580C Quick Setup Guide

Brother HL-5070N Command Reference Guide for Software Developers

Brother MFC-8910DW Open Source Licensing Remarks

Brother 2170W User Manual

Brother MFC-J6925DW Open Source Licensing Remarks

Brother DCP-8020 User's Guide

Brother ST371HD Specification

Brother HL-5470DW Open Source Licensing Remarks

Brother 8060 User Manual

Brother DCP-185C User Manual

Brother PT-2700 User Manual

Brother MFC-7840W Quick Setup Guide

Brother MFC-8840D Quick Setup Guide

Brother DCP8045D User Manual

Brother HL-5170DN Quick Setup Guide

Brother XR-9000 Operation Manual

Brother MFC-7345N Network User's Guide

Brother HL-4200CN Quick Setup Guide

Brother HL-4200CN User's Guide

Brother PT-9500PC User's Guide

Brother MFC-3220C User's Guide

Brother PT-1700 User's Guide

Brother MFC-7420 Quick Setup Guide

Brother MFC-5460CN Quick Setup Guide

Brother HL-L2360DW Open Source Licensing Remarks

Brother MFC-665CW User's Guide

Brother MFC-7345N Quick Setup Guide

Brother 560 User Manual

Brother HL-4040CDN Command Reference Guide for Software Developers

Brother 1940CN User Manual

Brother MFC-5460CN User Manual

Brother PT-1100 User Manual

Brother MFC-8860DN User Manual

Brother 1280 User Manual

Brother MFC-J650DW Open Source Licensing Remarks

Brother MFC-640CW Network User's Guide

Brother MFC-3360C User's Guide

Brother MFC J280W Open Source Licensing Remarks

Brother 1800 User Manual

Brother PT-1950 User's Guide

Brother FAX-2840 Open Source Licensing Remarks

Brother PT-1750 User Manual

Brother HL-2140 Quick Setup Guide

Brother MFC-8860DN Quick Setup Guide

Brother LS-1217 User's Guide

Brother HL-4070CDW User's Guide

Brother ADS2500W User Manual

Brother DCP-8065DN Network User's Guide

Brother HL-5070N Quick Setup Guide

Brother PS9000 User Manual

Brother MFC-7220 Quick Setup Guide

Brother MFC-685CW Network User's Guide

Brother MFC-820CW User's Guide

Brother 2900 User Manual

Brother SE1800 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother MFC-420CN Quick Setup Guide

Brother MFC-8660DN User's Guide

Brother 2340CV User Manual

Brother PE550D Warranty

Brother 1650 User Manual

Brother 1260 User Manual

Brother LN6226001 User Manual

Brother LA3776001 User Manual

Brother 565 User Manual

Brother MFC-L2720DW Open Source Licensing Remarks

Brother 882-W02 User Manual

Brother 7225n User Manual

Brother PT-2700 User's Guide

Brother QL-1050 User's Guide

Brother PT-1090 User's Guide

Brother MFC-J4310DW Open Source Licensing Remarks

Brother HL-5350DN Command Reference Guide for Software Developers

Brother DCP-770CW User Manual

Brother ST4031HD Use and Care Manual

Brother 1300 User Manual

Brother MFC-L8600CDW Open Source Licensing Remarks

Brother PT-2030 User Manual

Brother MFC-7820N Quick Setup Guide

Brother DCP-130C User's Guide

Brother 1230PC User Manual

Brother MFC-L8850CDW Open Source Licensing Remarks

Brother HS-2500 Quick Reference Guide

Brother DCP-8045D Network User's Guide

Brother HL-5050 Command Reference Guide for Software Developers

Brother HL-5070N User's Guide

Brother DCP-7030 User's Guide

Brother HL-5150D Command Reference Guide for Software Developers

Brother 1660e User Manual

Brother QL-700 Raster Command Reference

Brother BCL-D60 User Manual

Brother MFC-7840W User's Guide

Brother MFC-3320CN Quick Setup Guide

Brother HL-4050CDN User Manual

Brother 1010 User Manual

Brother HL-2240D Command Reference Guide for Software Developers

Brother LB5000M Warranty

Brother HL-6180DWT Open Source Licensing Remarks

Brother HL-L2380DW Open Source Licensing Remarks

Brother FAX-1940CN Quick Setup Guide

Brother 681B-UG User Manual

Brother HL-1450 Command Reference Guide for Software Developers

Brother HL-1650 Command Reference Guide for Software Developers

Brother MFC-8440 Quick Setup Guide

Brother 884-T05 User Manual

Brother LS-1717 User's Guide

Brother MFC-3820CN Quick Setup Guide

Brother HL-2600CN Quick Setup Guide/ Network Setup Guide

Brother MFC-8950DW Open Source Licensing Remarks

Brother FAX-8070P User Manual

Brother MFC-L2705DW Open Source Licensing Remarks

Brother ST371HD Use and Care Manual

Brother 3240C User Manual

Brother HL-4000CN User Manual

Brother HL-5280DW User's Guide

Brother HL-1435 Quick Setup Guide

Brother TD-4100N User's Guide

Brother 2500D User Manual

Brother 770 User Manual

Brother MFC-8870DW Network User's Guide

Brother MFC-640CW User's Guide

Brother MFC-685CW User's Guide

Brother HL-5250DN Quick Setup Guide

Brother MFC-J5920DW Open Source Licensing Remarks

Brother LW6091001 User Manual

Brother HL-7050N Quick Setup Guide

Brother BE-901-PC User Manual

Brother XL-6562 User's Guide

Brother DCP-350C User's Guide

Brother PT-1010 User's Guide

Brother SB4138 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother FAX-2580C User's Guide

Brother PT-2600 User's Guide

Brother MFC J825DW Open Source Licensing Remarks

Brother MFC-8460N Quick Setup Guide

Brother HL-L9200CDWT Open Source Licensing Remarks

Brother SE-400 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother SM2700 Use and Care Manual

Brother DK1219 User Manual

Brother MFC-640CW Quick Setup Guide

Brother SB8000 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother PT-1230PC User Manual

Brother PR1000e Operation Manual for Premium Pack I (Optional accessories)

Brother HL-2170W Quick Setup Guide

Brother FAX 2820 Quick Setup Guide

Brother MFC-8220 Quick Setup Guide

Brother MFC-8460N User's Guide

Brother MFC-8670DN Quick Setup Guide

Brother NX-250 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother 8065DN User Manual

Brother HL-2600CN Command Reference Guide for Software Developers

Brother PT-2710 User's Guide

Brother MFC-9440CN Quick Setup Guide

Brother CS7205 Notification about included accessories

Brother LN6645001 User Manual

Brother 882-U71 User Manual

Brother MFC-8860DN Network User's Guide

Brother PT-9800PCN Network User's Guide

Brother FAX 1920CN Network User's Guide

Brother HL-4040CN Quick Setup Guide

Brother DCP-8110DN Open Source Licensing Remarks

Brother NC-7100W User Manual

Brother PT-1290 User's Guide

Brother MFC-8670DN Network User's Guide

Brother MFC-5840CN User's Guide

Brother SX-4000 User Manual

Brother MFC J425W Open Source Licensing Remarks

Brother MFC-8860DN User's Guide

Brother 7420 User Manual

Brother PT-9400 User Manual

Brother 2440C User Manual

Brother 882-W01 User Manual

Brother BE-1201-PC User Manual

Brother 340 User Manual

Brother ML-300 User Manual

Brother MFC-7340 User's Guide

Brother MFC-9840CDW Network User's Guide

Brother DCP-8025D User Manual

Brother MFC-L2680W Open Source Licensing Remarks

Brother MFC-7820N User's Guide

Brother MFC-8220 Network User's Guide

Brother PT-1600 Quick Reference Guide

Brother HL-2070N Command Reference Guide for Software Developers

Brother HL-1250 Command Reference Guide for Software Developers

Brother PT-9700PC ESC/ P Command Reference

Brother FAX-2910 User's Guide

Brother SM2700 Warranty

Brother DCP-120C Quick Setup Guide

Brother FAX-2440C User's Guide

Brother DCP-7020 Quick Setup Guide

Brother HL-4070CDW Network User's Guide

Brother PT-1830 User's Guide

Brother DCP-8040 Quick Setup Guide

Brother 1290 User Manual

Brother 2920 User Manual

Brother N User Manual

Brother MFC-8640D Quick Setup Guide

Brother MFC-7240 Open Source Licensing Remarks

Brother PT-90 User's Guide

Brother DCP-110C Quick Setup Guide

Brother PT-2110 Software Installation Guide

Brother 1240 User Manual

Brother PT 2100 User's Guide

Brother MFC-8440 User's Guide

Brother HL-7050 Quick Setup Guide

Brother MFC-J245 Open Source Licensing Remarks

Brother MFC-8660DN Network User's Guide

Brother 530 User Manual

Brother 5840CN User Manual

Brother HL-7050 User's Guide

Brother DCP-165C User Manual

Brother 342Fi User Manual

Brother DCP-7020 User's Guide

Brother 1034D Specification

Brother 1810 User Manual

Brother SM1400 Warranty

Brother HL-5170DN User's Guide

Brother MFC-9440CN User's Guide

Brother FAX-1960C Quick Setup Guide

Brother MFC-J450DW Open Source Licensing Remarks

Brother MFC-4820C Quick Setup Guide

Brother MFC-230C Quick Setup Guide

Brother 885-S27 User Manual

Brother MFC-5440CN Network User's Guide

Brother PS-9000 Quick Setup Guide

Brother DCP-8025D User's Guide

Brother 2410 User Manual

Brother PED Basic User Manual

Brother 1250 User Manual

Brother DK1202 User Manual

Brother FAX 2820 User's Guide

Brother 8220 User Manual

Brother MFC-J680DW Open Source Licensing Remarks

Brother XR-65T User's Guide

Brother PT-2710 Software Installation Guide

Brother XL-6452 User's Guide

Brother MFC-465CN Quick Setup Guide

Brother 1180 User Manual

Brother MFC-5860CN User's Guide

Brother 2820 User Manual

Brother MFC-7225N Network User's Guide

Brother HL-2700CN Command Reference Guide for Software Developers

Brother SE425 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother MFC-4820C User's Guide

Brother 2210 User Manual

Brother PT-1230PC User's Guide

Brother DCP-330C User's Guide

Brother MFC-230C User's Guide

Brother PT-1280 User's Guide

Brother HL-6050DN Network User's Guide

Brother HL-5030 User Manual

Brother MFC-9420CN Network User's Guide

Brother WP330MDS User Manual

Brother MFC-5860CN User Manual

Brother PT 1000 User's Guide

Brother HL-2170W Command Reference Guide for Software Developers

Brother HL-1435 User's Guide

Brother MFC-8460N User Manual

Brother PE-300S User's Guide

Brother PS-9000 User's Guide

2000 Brother CM-2000 User Manual

Brother HL-4040CDN User's Guide

Brother 750E User Manual

Brother 1240 User Manual

Brother 2070N User Manual

Brother 2750 User Manual

Brother MFC-3340CN Quick Setup Guide

Brother 6000D User Manual

Brother 2820 User Manual

Brother QL-500 Quick Start Guide

Brother 1840C User Manual

Brother HL-2240 Command Reference Guide for Software Developers

Brother CP-7500 Quick Reference Guide

Brother MFC-J4420DW Open Source Licensing Remarks

Brother LN7629001 User Manual

Brother PT-1230PC User Manual

Brother BE-901 User Manual

Brother PT-1290 User Manual

Brother HL-4000CN User's Guide

Brother 2100 User Manual

Brother PT-1650 User's Guide

Brother MFC-820CW Quick Setup Guide

Brother LN9961001 User Manual

Brother MFC-885CW Network User's Guide

Brother MFC-J475DW Open Source Licensing Remarks

Brother HL-5140 User's Guide

Brother DCP-7045N User Manual

Brother BCL-D10 User Manual

Brother HL-5040 User's Guide

Brother 885 User Manual

Brother 7025 User Manual

Brother HL-L8250CDN Open Source Licensing Remarks

Brother MFC-7340 Quick Setup Guide

Brother FAX 1840C User's Guide

Brother DCP-8025D Quick Setup Guide

Brother PT-2030 User's Guide

Brother FAX-2800 Quick Setup Guide

Brother MFC-J885DW Open Source Licensing Remarks

Brother DCP-330C Quick Setup Guide

Brother PT-2030 User Manual

Brother 580MC User Manual

Brother HL-5450DN Open Source Licensing Remarks

Brother BAS-311G User Manual

Brother SC3000 Notification about included accessories

Brother MFC-8820DN Network User's Guide

Brother MFC-J4320DW Open Source Licensing Remarks

Brother 1660 User Manual

Brother LX-910D User Manual

Brother 884-T09 User Manual

Brother 4100e User Manual

Brother MFC-490CW Quick Setup Guide

Brother MFC-885CW User's Guide

Brother LN9049001 User Manual

Brother MFC-8950DWT Open Source Licensing Remarks

Brother HL-5030 Network User's Guide

Brother MFC-J5720DW Open Source Licensing Remarks

Brother DCP7010 User Manual

Brother MFC-5440CN User's Guide

Brother 8060P MFC-9060 User Manual

Brother 1800 User Manual

Brother MFC-8840D User Manual

Brother FAX 255 User Manual

Brother MFC-8870DW User's Guide

Brother Fax 1360 Quick Setup Guide

Brother 7600 User Manual

Brother LN9963001 User Manual

Brother MFC-7440N Quick Setup Guide

Brother 2200 User Manual

Brother MFC-8510DN Open Source Licensing Remarks

Brother HE-240 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother HL-L2300D Open Source Licensing Remarks

Brother HL-4070CDW Command Reference Guide for Software Developers

Brother PT-7100 User's Guide

Brother FAX-1860C User's Guide

Brother PT-1650 Quick Reference Guide

Brother 5750e User Manual

Brother HL-5250DN User's Guide

Brother HL-5050 Network User's Guide

Brother 3550 User Manual

Brother LX-900 User Manual

Brother BCL-D20 User Manual

Brother FAX 1920CN User Manual

Brother 1435 User Manual

Brother SE-270D Quick Reference Guide

Brother HL-3450CN Command Reference Guide for Software Developers

Brother XR-52C User's Guide

Brother 4750e User Manual

Brother HL-5280DW Quick Setup Guide

Brother PT-300 User Manual

Brother SM1704 Specification

Brother PT-9800PCN ESC/ P Command Reference

Brother 600 User Manual

Brother 2430PC User Manual

Brother hl-1270n Command Reference Guide for Software Developers

Brother BM-2700 User's Guide

Brother DCP-8045D Quick Setup Guide

Brother MFC-J880DW Open Source Licensing Remarks

Brother PT-7500 User's Guide

Brother PT-2700 Quick Setup Guide

Brother 2480C User Manual

Brother BE-1201B-AC-PC User Manual

Brother PT-2400 User's Guide

Brother MFC-J6520DW Open Source Licensing Remarks

Brother HL-1670N Quick Setup Guide

Brother HL-5040 Network User's Guide

Brother PT-2030AD User's Guide

Brother MFC-8440 Network User's Guide

Brother QL-570VM Quick Reference Guide

Brother 1200 User Manual

Brother PT-320 User Manual

Brother HL-L8350CDW Open Source Licensing Remarks

Brother MFC-5490CN User's Guide

Brother MFC-3820CN Network User's Guide

Brother LN7424001 User Manual

Brother HL-2150N User Manual

Brother MFC-8870DW User Manual

Brother HL-2070N User's Guide

Brother DCP-7040 User's Guide

Brother DK1204 User Manual

Brother LS 30 User's Guide

Brother HL-5070N User Manual

Brother PED Basic Instruction Manual

Brother SE-350 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother DCP-7040 Quick Setup Guide

Brother DZ2400 Notification about included accessories

Brother MFC-665CW Quick Setup Guide

Brother MFC-8840DN User's Guide

Brother QL-1050N User's Guide

Brother HL-L2305W Open Source Licensing Remarks

Brother CS-8060 User's Guide

Brother SE-270D User's Guide

Brother HL-2220 Command Reference Guide for Software Developers

Brother NX570Q Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother HL-5140 Quick Setup Guide

Brother 2030 User Manual

Brother 2040 User Manual

Brother 1060 User Manual

Brother MFC-7225N User's Guide

Brother MFC-J6920DW Open Source Licensing Remarks

Brother MFC-5840CN Quick Setup Guide

Brother MFC-J6720DW Open Source Licensing Remarks

Brother LS-590 User's Guide

Brother HL-4040CN User Manual

Brother DCP-145C User Manual

Brother LW1704001 User Manual

Brother 8440 User Manual

Brother PT-2730 User Manual

Brother QL-1060N User's Guide

Brother QL-600 Raster Command Reference

Brother MFC-620CN Quick Setup Guide

Brother HL-1850 Command Reference Guide for Software Developers

Brother DK1241 User Manual

Brother HL-2700CN User's Guide

Brother HL-2700CN Network User's Guide

Brother DCP-8040 User's Guide

Brother SM2700 Notification about built-in utility stitches, features and included accessories

Brother QL-550 User's Guide

Brother XR-7700 Quick Start Guide

Brother MFC-7220 User's Guide

Brother DK1203 User Manual

Brother BES-916 User Manual

Brother MFC-440CN Network User's Guide

Brother MFC-5460CN User's Guide

Brother SM1400 Specification

Brother MFC-3240C User's Guide

Brother HL-2170W Network User's Guide

Brother DCP8040 User Manual

Brother DCP-8020 Network User's Guide

Brother MFC-5440CN Quick Setup Guide

Brother HL-5030 Quick Setup Guide

Brother HL-L2320D Open Source Licensing Remarks

Brother SV-100B User Manual

Brother PT-1400 Quick Reference Guide

Brother FAX-2480C User's Guide

Brother DCP 8060 User's Guide

Brother PE-DESIGN 7 User Manual

Brother MFC-210C User's Guide

Brother MFC-3360C Quick Setup Guide

Brother HL-2230 Command Reference Guide for Software Developers

Brother QL-570 User's Guide

Brother PT-P750W Open Source Licensing Remarks

Brother DK1218 User Manual

Brother MFC-5860CN Network User's Guide

Brother HL-5050 User's Guide

Brother MFC-J285DW Open Source Licensing Remarks

Brother MFC-7820N Network User's Guide

Brother JX2517 Quick Reference Guide

Brother MFC-L2740DW Open Source Licensing Remarks

Brother 1 User Manual

Brother SE1900 Warranty

Brother QL-1050 Quick Start Guide

Brother QL-500 User's Guide

Brother HL-5170DN Network User's Guide

Brother CP100X Warranty

Brother HL-L8350CDWT Open Source Licensing Remarks

Brother PT-70 User's Guide

Brother HL-4040CN Command Reference Guide for Software Developers

Brother MFC-685CW Quick Setup Guide

Brother MFC J430w Open Source Licensing Remarks

Brother HL-5440D Open Source Licensing Remarks

Brother QL-650TD User's Guide

Brother MFC-440CN User's Guide

Brother FAX-1940CN User's Guide

Brother FAX 1840C Quick Setup Guide

Brother DVR-N4 User Manual

Brother FAX-2920 User's Guide

Brother Fax 1360 User Manual

Brother SDX125E Instructions / Assembly

Brother PT-2110 User's Guide

Brother MFC-J460DW Open Source Licensing Remarks

Brother MFC-J5520DW Open Source Licensing Remarks

Brother 750 User Manual

Brother MFC-J470DW Open Source Licensing Remarks

Brother CS7000i Warranty

Brother 515 User Manual

Brother PT-2430PC User's Guide

Brother MFC-8840D Network User's Guide

Brother FAX-2900 Quick Setup Guide

Brother PT-1180 User's Guide

Brother MFC-7440N Network User's Guide

Brother NC6100H User Manual

Brother HL-1470N Command Reference Guide for Software Developers

Brother HL-4050CDN User Manual

Brother SM1704 Use and Care Manual

Brother HL-7050 Network User's Guide

Brother MFC-8420 Network User's Guide

Brother LX-1200 User Manual

Brother HL-1870N Command Reference Guide for Software Developers

Brother DK1207 User Manual

Brother MFC-8670DN User's Guide

Brother DCP-8065DN Quick Setup Guide

Brother PT-1800 User's Guide

Brother MFC-3320CN Network User's Guide

Brother CP-6500 Quick Reference Guide

Brother LN7808001 User Manual

Brother 1840C User Manual

Brother SM3701 Warranty

Brother MFC-885CW Quick Setup Guide

Brother ST4031HD Warranty

Brother MFC-3820CN User's Guide

Brother DCP-350C Quick Setup Guide

Brother MFC-7420 User's Guide

Brother CS-80 User's Guide

Brother MFC-8640D User's Guide

Brother LS-1520 User's Guide

Brother 1830 User Manual

Brother MFC-440CN Quick Setup Guide

Brother HL-6050DN User's Guide

Brother HL-2270DW Command Reference Guide for Software Developers

Brother HL-2070N Quick Setup Guide

Brother HL-5130 User Manual

Brother MFC-J5620DW Open Source Licensing Remarks

Brother PT-80 User Manual

Brother PT-1500PC User Manual

Brother NX-600 Quick Reference Guide

Brother CS7000i Notification about included accessories

Brother 1575MC User Manual

Brother DCP-165C Quick Setup Guide

Brother DK1208 User Manual

Brother MFC-420CN Network User's Guide

Brother HL-5150D User's Guide

Brother MFC-3340CN Network User's Guide

Brother HL-2600CN User's Guide

Brother 2300 User Manual

Brother HL-2700CN Quick Setup Guide

Brother DCP7025 User Manual

Brother DCP-7030 Quick Setup Guide

Brother MFC-845CW Network User's Guide

Brother MFC-8840DN Quick Setup Guide

Brother HL-5050 Quick Setup Guide

Brother MFC-8840DN Network User's Guide

Brother PT-9500PC Software Installation Guide

Brother MFC-J870DW Open Source Licensing Remarks

Brother DK1201 User Manual

Brother QL-580N User's Guide

Brother HL-5040 User Manual

Brother MFC-L9550CDW Open Source Licensing Remarks

Brother PT-1810 User's Guide

Brother HL-L2340DW Open Source Licensing Remarks

Brother HL-1850 User's Guide

Brother DCP-L2520DW Open Source Licensing Remarks

Brother DCP-9045CDN User Manual

Brother HL-7050 Command Reference Guide for Software Developers

Brother 1880 User Manual

Brother 660MC User Manual

Brother FAX-1960C User's Guide

Brother PT-1750 User's Guide

Brother PT-1500PC Quick Reference Guide

Brother MFC-465CN User's Guide

Brother MFC-8710DW Open Source Licensing Remarks

Brother MFC-5840CN User Manual

Brother HL-5280DW Network User's Guide

Brother 600 User Manual

Brother PT-2700 Software Installation Guide

Brother HL-7050N Network User's Guide

Brother MFC-820CW Network User's Guide

Brother 1820C User Manual

Brother PR 1000 Operation Manual for Premium Pack I (Optional accessories)

Brother HL-5250DN Network User's Guide

Brother HL-5150D User Manual

Brother MFC-7345N User's Guide

Brother 8840D User Manual

Brother MFC-8810DW Open Source Licensing Remarks

Brother 855-X06 User Manual

Brother MFC-J4410DW Open Source Licensing Remarks

Brother CS7000i Replacement Part List

Brother HL-5470DWT Open Source Licensing Remarks

Brother NX-600 Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother 285 User Manual

Brother MFC-9070 User Manual

Brother 3.1 User Manual

Brother 7010 User Manual

Brother SM1704 Replacement Part List

Brother HL-5340D Command Reference Guide for Software Developers

Brother 3034D User Manual

Brother ML100 User Manual

Brother HL-5240 Quick Setup Guide

Brother NC9100H User Manual

Brother MFC-5460CN Network User's Guide

Brother GT541 User Manual

Brother DK1221 User Manual

Brother HL-5150DN User Manual

Brother PT-1600 User Manual

Brother MFC-665CW Network User's Guide

Brother PC-6500 User's Guide

Brother QL-1050N Quick Start Guide

Brother PT-9500PC Quick Reference Guide

Brother HL-2140 User's Guide

Brother 4000D User Manual

Brother MFC-8640D Network User's Guide

Brother MFC-8440 User Manual

Brother 8045D User Manual

Brother HL-4040CDN Network User's Guide

Brother HL-5140 Command Reference Guide for Software Developers

Brother MFC-J480DW Open Source Licensing Remarks

Brother PT-9600 User's Guide

Brother HL-3450CN User's Guide

Brother HL-6050DN Command Reference Guide for Software Developers

Brother MFC-J485DW Open Source Licensing Remarks

Brother HL-4040CDN Quick Setup Guide

Brother 2400 User Manual

Brother PT-2710 Quick Setup Guide

Brother 7030 User Manual

Brother SM1400 Replacement Part List

Brother MFC-240C User's Guide

Brother HL-5250DN Command Reference Guide for Software Developers

Brother PT-7600 User's Guide

Brother BE-0901E-AC-PC User Manual

Brother MFC-7225N Quick Setup Guide

Brother DCP-8150DN Open Source Licensing Remarks

Brother ST371HD Warranty

Brother HL-2170W User's Guide

Brother HL-5030 User's Guide

Brother HL-4070CDW Quick Setup Guide

Brother 7840W User Manual

Brother MFC-620CN User's Guide

Brother 1000 User Manual

Brother MFC-8660DN Quick Setup Guide

Brother HL-2070N Network User's Guide

Brother 2460 User Manual

Brother PT-2730 Software Installation Guide

Brother MFC-420CN User's Guide

Brother DCP 8060 Quick Setup Guide

Brother HL-2140 Command Reference Guide for Software Developers

Brother HL-1670N Command Reference Guide for Software Developers

Brother XR9550 Warranty

Brother MFC-7840W Network User's Guide

Brother HL-2460 Command Reference Guide for Software Developers

Brother CS5055 Warranty

Brother TD-4000 Additional Operation Guide (Connecting a Barcode Scanner)

Brother DCP-8040 User Manual

Brother DK1209 User Manual

Brother 2340CV Warranty

Brother PT-2730 User's Guide

Brother NX-650Q Operational manual for Bobbin Work Kit. (Optional accessory: SABWRK1)

Brother HL-1650 Quick Setup Guide

Brother 4100 User Manual

Brother EM-630 User Manual

Brother MFC-465CN Network User's Guide

Brother 560 User Manual

Brother HL-4040CN User's Guide

Brother MFC-5440CN User Manual

Brother HL-7050N Command Reference Guide for Software Developers

Brother HL-5050 User Manual

Brother MFC-410CN User Manual

Brother HL 2040 Quick Setup Guide

Brother PT 2100 Software Installation Guide

Brother MFC-L2700DW Open Source Licensing Remarks

Brother FAX-2440C Quick Setup Guide

Brother BM-2700 Quick Start Guide

Brother BM-3600 User's Guide

Brother MFC-660CN User Manual

Brother DCP-130C Quick Setup Guide

Brother 7500 User Manual

Brother DCP-8155DN Open Source Licensing Remarks

Brother MFC-8820D Network User's Guide

Brother 885-U22 User Manual

Brother pt300 User Manual

Brother 540 User Manual

Brother HL-7050N User's Guide

Brother HL-5070N Network User's Guide

Brother HL-5040 Command Reference Guide for Software Developers

Brother 285C User Manual

Brother MFC-4420C Quick Setup Guide

Brother CS-8072 User's Guide

Brother 3800 User Manual

Brother FAX-1820C User's Guide

Brother DCP-8065DN User's Guide

Brother MFC-3240C Quick Setup Guide

Brother MFC-845CW User's Guide

Brother 1960C User Manual